Nkx3.1 (NKX3-1) (NM_006167) Human Mass Spec Standard

CAT#: PH310374

NKX3 MS Standard C13 and N15-labeled recombinant protein (NP_006158)

Product Images

Coomassie blue staining of purified NKX3-1 protein (Cat# TP310374). The protein was produced from HEK293T cells transfected with NKX3-1 cDNA clone (Cat# RC210374) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210374
• Predicted MW: 26.4 kDa
• Protein Sequence:
  Sequence Link

  >RC210374 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAG
  AQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELE
  RKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASL
  VSVYNSYPYYPYLYCVGSWSPAFW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006158
• RefSeq Size: 3281
• RefSeq ORF: 702
• Synonyms: BAPX2; NKX3; NKX3.1; NKX3A
• Locus ID: 4824
• UniProt ID: Q99801
• Cytogenetics: 8p21.2
• Summary: 'This gene encodes a homeobox-containing transcription factor. This transcription factor functions as a negative regulator of epithelial cell growth in prostate tissue. Aberrant expression of this gene is associated with prostate tumor progression. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jan 2012]'
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Pathways in cancer, Prostate cancer