Nkx3.1 (NKX3-1) (NM_006167) Human Recombinant Protein

CAT#: TP310374

Recombinant protein of human NK3 homeobox 1 (NKX3-1)

Product Images

Coomassie blue staining of purified NKX3-1 protein (Cat# TP310374). The protein was produced from HEK293T cells transfected with NKX3-1 cDNA clone (Cat# RC210374) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210374 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAG
  AQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELE
  RKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASL
  VSVYNSYPYYPYLYCVGSWSPAFW
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006158
• Locus ID: 4824
• UniProt ID: Q99801
• Cytogenetics: 8p21.2
• Refseq Size: 3281
• Refseq ORF: 702
• Synonyms: BAPX2; NKX3; NKX3.1; NKX3A
• Summary: This gene encodes a homeobox-containing transcription factor. This transcription factor functions as a negative regulator of epithelial cell growth in prostate tissue. Aberrant expression of this gene is associated with prostate tumor progression. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jan 2012]
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Pathways in cancer, Prostate cancer