Proteasome subunit beta type 2 (PSMB2) (NM_002794) Human Mass Spec Standard
CAT#: PH310452
PSMB2 MS Standard C13 and N15-labeled recombinant protein (NP_002785)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210452 |
Predicted MW | 22.8 kDa |
Protein Sequence |
>RC210452 protein sequence
Red=Cloning site Green=Tags(s) MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMR NGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTL SILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002785 |
RefSeq Size | 4759 |
RefSeq ORF | 603 |
Synonyms | HC7-I |
Locus ID | 5690 |
UniProt ID | P49721, A0A140VJS6 |
Cytogenetics | 1p34.3 |
Summary | 'The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2010]' |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Proteasome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419104 | PSMB2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419104 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 2 (PSMB2) |
USD 396.00 |
|
TP310452 | Recombinant protein of human proteasome (prosome, macropain) subunit, beta type, 2 (PSMB2) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review