ARL13B (NM_144996) Human Mass Spec Standard
CAT#: PH310490
ARL13B MS Standard C13 and N15-labeled recombinant protein (NP_659433)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210490 |
Predicted MW | 36.8 kDa |
Protein Sequence |
>RC210490 protein sequence
Red=Cloning site Green=Tags(s) MFSLMASCCGWFKRWREPVRLANKQDKEGALGEADVIECLSLEKLVNEHKCLCQIEPCSAISGYGKKIDK SIKKGLYWLLHVIARDFDALNERIQKETTEQRALEEQEKQERAERVRKLREERKQNEQEQAELDGTSGLA ELDPEPTNPFQPIASVIIENEGKLEREKKNQKMEKDSDGCHLKHKMEHEQIETQGQVNHNGQKNNEFGLV ENYKEALTQQLKNEDETDRPSLESANGKKKTKKLRMKRNHRVEPLNIDDCAPESPTPPPPPPPVGWGTPK VTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPNSDAHDVIS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_659433 |
RefSeq Size | 3670 |
RefSeq ORF | 963 |
Synonyms | ARL2L1; JBTS8 |
Locus ID | 200894 |
UniProt ID | Q3SXY8 |
Cytogenetics | 3q11.1-q11.2 |
Summary | This gene encodes a member of the ADP-ribosylation factor-like family. The encoded protein is a small GTPase that contains both N-terminal and C-terminal guanine nucleotide-binding motifs. This protein is localized in the cilia and plays a role in cilia formation and in maintenance of cilia. Mutations in this gene are the cause of Joubert syndrome 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405389 | ARL13B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC408134 | ARL13B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC432892 | ARL13B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY405389 | Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 1 |
USD 495.00 |
|
LY408134 | Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 2 |
USD 325.00 |
|
LY432892 | Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 4 |
USD 325.00 |
|
PH321949 | ARL13B MS Standard C13 and N15-labeled recombinant protein (NP_878899) |
USD 2,055.00 |
|
TP310490 | Recombinant protein of human ADP-ribosylation factor-like 13B (ARL13B), transcript variant 2 |
USD 867.00 |
|
TP321949 | Recombinant protein of human ADP-ribosylation factor-like 13B (ARL13B), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review