ARL13B (NM_144996) Human Recombinant Protein
CAT#: TP310490
Recombinant protein of human ADP-ribosylation factor-like 13B (ARL13B), transcript variant 2
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210490 protein sequence
Red=Cloning site Green=Tags(s) MFSLMASCCGWFKRWREPVRLANKQDKEGALGEADVIECLSLEKLVNEHKCLCQIEPCSAISGYGKKIDK SIKKGLYWLLHVIARDFDALNERIQKETTEQRALEEQEKQERAERVRKLREERKQNEQEQAELDGTSGLA ELDPEPTNPFQPIASVIIENEGKLEREKKNQKMEKDSDGCHLKHKMEHEQIETQGQVNHNGQKNNEFGLV ENYKEALTQQLKNEDETDRPSLESANGKKKTKKLRMKRNHRVEPLNIDDCAPESPTPPPPPPPVGWGTPK VTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPNSDAHDVIS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 36.6 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_659433 |
| Locus ID | 200894 |
| UniProt ID | Q3SXY8 |
| Cytogenetics | 3q11.1-q11.2 |
| Refseq Size | 3670 |
| Refseq ORF | 963 |
| Synonyms | ARL2L1; JBTS8 |
| Summary | This gene encodes a member of the ADP-ribosylation factor-like family. The encoded protein is a small GTPase that contains both N-terminal and C-terminal guanine nucleotide-binding motifs. This protein is localized in the cilia and plays a role in cilia formation and in maintenance of cilia. Mutations in this gene are the cause of Joubert syndrome 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405389 | ARL13B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC408134 | ARL13B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC432892 | ARL13B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY405389 | Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 1 |
USD 665.00 |
|
| LY408134 | Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 2 |
USD 436.00 |
|
| LY432892 | Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 4 |
USD 436.00 |
|
| PH310490 | ARL13B MS Standard C13 and N15-labeled recombinant protein (NP_659433) |
USD 2,055.00 |
|
| PH321949 | ARL13B MS Standard C13 and N15-labeled recombinant protein (NP_878899) |
USD 2,055.00 |
|
| TP321949 | Recombinant protein of human ADP-ribosylation factor-like 13B (ARL13B), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China