Alkaline Phosphatase (ALPP) (NM_001632) Human Mass Spec Standard
CAT#: PH310504
ALPP MS Standard C13 and N15-labeled recombinant protein (NP_001623)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210504 |
Predicted MW | 58 kDa |
Protein Sequence |
>RC210504 protein sequence
Red=Cloning site Green=Tags(s) MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVST VTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARF NQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIAT QLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASL DPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRAL TETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPG YVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACL EPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001623 |
RefSeq Size | 2883 |
RefSeq ORF | 1605 |
Synonyms | ALP; ALPI; IAP; PALP; PLAP; PLAP-1 |
Locus ID | 250 |
UniProt ID | P05187, B2R7C7 |
Cytogenetics | 2q37.1 |
Summary | 'The protein encoded by this gene is an alkaline phosphatase, a metalloenzyme that catalyzes the hydrolysis of phosphoric acid monoesters. It belongs to a multigene family composed of four alkaline phosphatase isoenzymes. The enzyme functions as a homodimer and has a catalytic site containing one magnesium and two zinc ions, which are required for its enzymatic function. One of the main sources of this enzyme is the liver, and thus, it's one of several indicators of liver injury in different clinical conditions. In pregnant women, this protein is primarily expressed in placental and endometrial tissue, however, strong ectopic expression has been detected in ovarian adenocarcinoma, serous cystadenocarcinoma, and other ovarian cancer cells. [provided by RefSeq, Aug 2020]' |
Protein Pathways | Folate biosynthesis, Metabolic pathways |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419831 | ALPP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY419831 | Transient overexpression lysate of alkaline phosphatase, placental (Regan isozyme) (ALPP) |
USD 325.00 |
|
TP310504 | Recombinant protein of human alkaline phosphatase, placental (Regan isozyme) (ALPP) |
USD 823.00 |
|
TP721056 | Purified recombinant protein of Human alkaline phosphatase, placental (ALPP) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review