ARFRP1 (NM_003224) Human Mass Spec Standard

CAT#: PH310518

ARFRP1 MS Standard C13 and N15-labeled recombinant protein (NP_003215)

Product Images

Coomassie blue staining of purified ARFRP1 protein (Cat# TP310518). The protein was produced from HEK293T cells transfected with ARFRP1 cDNA clone (Cat# RC210518) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210518
• Predicted MW: 22.6 kDa
• Protein Sequence:
  Sequence Link

  >RC210518 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKAR
  LMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVET
  CLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003215
• RefSeq Size: 2571
• RefSeq ORF: 603
• Synonyms: ARL18; ARP; Arp1
• Locus ID: 10139
• UniProt ID: Q13795, A0A384P5U7
• Cytogenetics: 20q13.33
• Summary: The protein encoded by this gene is a membrane-associated GTP-ase which localizes to the plasma membrane and is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) proteins. This gene plays a role in membrane trafficking between the trans-Golgi network and endosomes. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, May 2012]