ARFRP1 (NM_003224) Human Recombinant Protein
CAT#: TP310518
Recombinant protein of human ADP-ribosylation factor related protein 1 (ARFRP1), transcript variant 1
View other "ARFRP1" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210518 protein sequence
Red=Cloning site Green=Tags(s) MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKAR LMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVET CLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003215 |
Locus ID | 10139 |
UniProt ID | Q13795, A0A384P5U7 |
Cytogenetics | 20q13.33 |
Refseq Size | 2571 |
Refseq ORF | 603 |
Synonyms | ARL18; ARP; Arp1 |
Summary | The protein encoded by this gene is a membrane-associated GTP-ase which localizes to the plasma membrane and is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) proteins. This gene plays a role in membrane trafficking between the trans-Golgi network and endosomes. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, May 2012] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418821 | ARFRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427485 | ARFRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418821 | Transient overexpression lysate of ADP-ribosylation factor related protein 1 (ARFRP1), transcript variant 1 |
USD 396.00 |
|
LY427485 | Transient overexpression lysate of ADP-ribosylation factor related protein 1 (ARFRP1), transcript variant 2 |
USD 396.00 |
|
PH310518 | ARFRP1 MS Standard C13 and N15-labeled recombinant protein (NP_003215) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review