Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_212471) Human Mass Spec Standard
CAT#: PH310623
PRKAR1A MS Standard C13 and N15-labeled recombinant protein (NP_997636)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210623 |
Predicted MW | 43 kDa |
Protein Sequence |
>RC210623 protein sequence
Red=Cloning site Green=Tags(s) MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKEEAKQIQNLQK AGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSH LDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQGETDVYVNNEWATSVGEGGSFGELALIYGTP RAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQ KIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKL DRPRFERVLGPCSDILKRNIQQYNSFVSLSV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_997636 |
RefSeq Size | 4518 |
RefSeq ORF | 1143 |
Synonyms | ACRDYS1; ADOHR; CAR; CNC; CNC1; PKR1; PPNAD1; PRKAR1; TSE1 |
Locus ID | 5573 |
UniProt ID | P10644, B2R5T5 |
Cytogenetics | 17q24.2 |
Summary | 'cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. This gene encodes one of the regulatory subunits. This protein was found to be a tissue-specific extinguisher that down-regulates the expression of seven liver genes in hepatoma x fibroblast hybrids. Mutations in this gene cause Carney complex (CNC). This gene can fuse to the RET protooncogene by gene rearrangement and form the thyroid tumor-specific chimeric oncogene known as PTC2. A nonconventional nuclear localization sequence (NLS) has been found for this protein which suggests a role in DNA replication via the protein serving as a nuclear transport protein for the second subunit of the Replication Factor C (RFC40). Several alternatively spliced transcript variants encoding two different isoforms have been observed. [provided by RefSeq, Jan 2013]' |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Apoptosis, Insulin signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400963 | PRKAR1A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC403944 | PRKAR1A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC403945 | PRKAR1A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431006 | PRKAR1A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400963 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 1 |
USD 396.00 |
|
LY403944 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2 |
USD 396.00 |
|
LY403945 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 3 |
USD 396.00 |
|
LY431006 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2 |
USD 396.00 |
|
PH303828 | PRKAR1A MS Standard C13 and N15-labeled recombinant protein (NP_002725) |
USD 2,055.00 |
|
PH312810 | PRKAR1A MS Standard C13 and N15-labeled recombinant protein (NP_997637) |
USD 2,055.00 |
|
TP303828 | Recombinant protein of human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 1 |
USD 439.00 |
|
TP310623 | Recombinant protein of human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2 |
USD 823.00 |
|
TP312810 | Recombinant protein of human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review