ROMO1 (NM_080748) Human Mass Spec Standard

CAT#: PH310655

ROMO1 MS Standard C13 and N15-labeled recombinant protein (NP_542786)

Product Images

Coomassie blue staining of purified ROMO1 protein (Cat# TP310655). The protein was produced from HEK293T cells transfected with ROMO1 cDNA clone (Cat# RC210655) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210655
• Predicted MW: 8.2 kDa
• Protein Sequence:
  Sequence Link

  >RC210655 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTF
  MAIGMGIRC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_542786
• RefSeq Size: 477
• RefSeq ORF: 237
• Synonyms: bA353C18.2; C20orf52; MTGM; MTGMP
• Locus ID: 140823
• UniProt ID: P60602
• Cytogenetics: 20q11.22
• Summary: The protein encoded by this gene is a mitochondrial membrane protein that is responsible for increasing the level of reactive oxygen species (ROS) in cells. The protein also has antimicrobial activity against a variety of bacteria by inducing bacterial membrane breakage. [provided by RefSeq, Nov 2014]
• Protein Families: Transmembrane