ROMO1 (NM_080748) Human Recombinant Protein

CAT#: TP310655

Recombinant protein of human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein

Product Images

Coomassie blue staining of purified ROMO1 protein (Cat# TP310655). The protein was produced from HEK293T cells transfected with ROMO1 cDNA clone (Cat# RC210655) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210655 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTF
  MAIGMGIRC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_542786
• Locus ID: 140823
• UniProt ID: P60602
• Cytogenetics: 20q11.22
• Refseq Size: 477
• Refseq ORF: 237
• Synonyms: bA353C18.2; C20orf52; MTGM; MTGMP
• Summary: The protein encoded by this gene is a mitochondrial membrane protein that is responsible for increasing the level of reactive oxygen species (ROS) in cells. The protein also has antimicrobial activity against a variety of bacteria by inducing bacterial membrane breakage. [provided by RefSeq, Nov 2014]
• Protein Families: Transmembrane