RAB5C (NM_201434) Human Mass Spec Standard

CAT#: PH310698

RAB5C MS Standard C13 and N15-labeled recombinant protein (NP_958842)

Product Images

Coomassie blue staining of purified RAB5C protein (Cat# TP310698). The protein was produced from HEK293T cells transfected with RAB5C cDNA clone (Cat# RC210698) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210698
• Predicted MW: 23.3 kDa
• Protein Sequence:
  Sequence Link

  >RC210698 representing NM_201434
  Red=Cloning site Green=Tags(s)
  
  MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTV
  KFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLAS
  KRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASR
  SQCCSN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_958842
• RefSeq Size: 1791
• RefSeq ORF: 648
• Synonyms: L1880; RAB5CL; RAB5L; RABL
• Locus ID: 5878
• UniProt ID: P51148, A0A024R1U4
• Cytogenetics: 17q21.2
• Summary: 'Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment (Han et al., 1996 [PubMed 8646882]).[supplied by OMIM, Nov 2010]'
• Protein Families: Druggable Genome
• Protein Pathways: Endocytosis