RAB5C (NM_201434) Human Recombinant Protein
CAT#: TP310698
Purified recombinant protein of Homo sapiens RAB5C, member RAS oncogene family (RAB5C), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210698 representing NM_201434
Red=Cloning site Green=Tags(s) MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTV KFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLAS KRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASR SQCCSN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Bioactivity | Enzyme activity (PMID: 26030178) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_958842 |
Locus ID | 5878 |
UniProt ID | P51148, A0A024R1U4 |
Cytogenetics | 17q21.2 |
Refseq Size | 1791 |
Refseq ORF | 648 |
Synonyms | L1880; RAB5CL; RAB5L; RABL |
Summary | Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment (Han et al., 1996 [PubMed 8646882]).[supplied by OMIM, Nov 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404416 | RAB5C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY404416 | Transient overexpression lysate of RAB5C, member RAS oncogene family (RAB5C), transcript variant 1 |
USD 325.00 |
|
PH310698 | RAB5C MS Standard C13 and N15-labeled recombinant protein (NP_958842) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review