RAB5C (NM_201434) Human Recombinant Protein

CAT#: TP310698

Purified recombinant protein of Homo sapiens RAB5C, member RAS oncogene family (RAB5C), transcript variant 1

Product Images

Coomassie blue staining of purified RAB5C protein (Cat# TP310698). The protein was produced from HEK293T cells transfected with RAB5C cDNA clone (Cat# RC210698) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210698 representing NM_201434
  Red=Cloning site Green=Tags(s)
  
  MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTV
  KFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLAS
  KRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASR
  SQCCSN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Enzyme activity (PMID: 26030178)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_958842
• Locus ID: 5878
• UniProt ID: P51148, A0A024R1U4
• Cytogenetics: 17q21.2
• Refseq Size: 1791
• Refseq ORF: 648
• Synonyms: L1880; RAB5CL; RAB5L; RABL
• Summary: Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment (Han et al., 1996 [PubMed 8646882]).[supplied by OMIM, Nov 2010]
• Protein Families: Druggable Genome
• Protein Pathways: Endocytosis