Peroxiredoxin 5 (PRDX5) (NM_012094) Human Mass Spec Standard
CAT#: PH310709
PRDX5 MS Standard C13 and N15-labeled recombinant protein (NP_036226)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210709 |
Predicted MW | 22 kDa |
Protein Sequence |
>RC210709 protein sequence
Red=Cloning site Green=Tags(s) MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEG EPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRA HKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNI ISQL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_036226 |
RefSeq Size | 913 |
RefSeq ORF | 642 |
Synonyms | ACR1; AOEB166; B166; HEL-S-55; PLP; PMP20; PRDX6; prx-V; PRXV; SBBI10 |
Locus ID | 25824 |
UniProt ID | P30044 |
Cytogenetics | 11q13.1 |
Summary | This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein interacts with peroxisome receptor 1 and plays an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. The use of alternate transcription start sites is thought to result in transcript variants that use different in-frame translational start codons to generate isoforms that are targeted to the mitochondrion (isoform L) or peroxisome/cytoplasm (isoform S). Multiple related pseudogenes have been defined for this gene. [provided by RefSeq, Nov 2017] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402144 | PRDX5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC405741 | PRDX5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430552 | PRDX5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402144 | Transient overexpression lysate of peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 396.00 |
|
LY405741 | Transient overexpression lysate of peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 396.00 |
|
LY430552 | Transient overexpression lysate of peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 396.00 |
|
PH317362 | PRDX5 MS Standard C13 and N15-labeled recombinant protein (NP_857635) |
USD 2,055.00 |
|
PH324020 | PRDX5 MS Standard C13 and N15-labeled recombinant protein (NP_857634) |
USD 2,055.00 |
|
TP310709 | Recombinant protein of human peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 823.00 |
|
TP317362 | Recombinant protein of human peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 748.00 |
|
TP324020 | Recombinant protein of human peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review