Peroxiredoxin 5 (PRDX5) (NM_181651) Human Mass Spec Standard

CAT#: PH324020

PRDX5 MS Standard C13 and N15-labeled recombinant protein (NP_857634)

Product Images

Coomassie blue staining of purified PRDX5 protein (Cat# TP324020). The protein was produced from HEK293T cells transfected with PRDX5 cDNA clone (Cat# RC224020) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224020
• Predicted MW: 17.4 kDa
• Protein Sequence:
  Sequence Link

  >RC224020 representing NM_181651
  Red=Cloning site Green=Tags(s)
  
  MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEG
  EPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMV
  VQDGIVKALNVEPDGTGLTCSLAPNIISQL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_857634
• RefSeq Size: 781
• RefSeq ORF: 510
• Synonyms: ACR1; AOEB166; B166; HEL-S-55; PLP; PMP20; PRDX6; prx-V; PRXV; SBBI10
• Locus ID: 25824
• UniProt ID: P30044
• Cytogenetics: 11q13.1
• Summary: This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein interacts with peroxisome receptor 1 and plays an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. The use of alternate transcription start sites is thought to result in transcript variants that use different in-frame translational start codons to generate isoforms that are targeted to the mitochondrion (isoform L) or peroxisome/cytoplasm (isoform S). Multiple related pseudogenes have been defined for this gene. [provided by RefSeq, Nov 2017]
• Protein Families: Druggable Genome