TXNIP (NM_006472) Human Mass Spec Standard

CAT#: PH310804

TXNIP MS Standard C13 and N15-labeled recombinant protein (NP_006463)

Product Images

Coomassie blue staining of purified TXNIP protein (Cat# TP310804). The protein was produced from HEK293T cells transfected with TXNIP cDNA clone (Cat# RC210804) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210804
• Predicted MW: 43.7 kDa
• Protein Sequence:
  Sequence Link

  >RC210804 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYL
  RYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETK
  KNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTCSRIVV
  PKAAIVARHTYLANGQTKVLTQKLSSVRGNHIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYV
  SVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTP
  LLDDMDGSQDSPIFMYAPEFKFMPPPTYTEVDPCILNNNVQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006463
• RefSeq Size: 2979
• RefSeq ORF: 1173
• Synonyms: ARRDC6; EST01027; HHCPA78; THIF; VDUP1
• Locus ID: 10628
• UniProt ID: Q9H3M7
• Cytogenetics: 1q21.1
• Summary: This gene encodes a thioredoxin-binding protein that is a member of the alpha arrestin protein family. Thioredoxin is a thiol-oxidoreductase that is a major regulator of cellular redox signaling which protects cells from oxidative stress. This protein inhibits the antioxidative function of thioredoxin resulting in the accumulation of reactive oxygen species and cellular stress. This protein also functions as a regulator of cellular metabolism and of endoplasmic reticulum (ER) stress. This protein may also function as a tumor suppressor. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
• Protein Families: Druggable Genome