CPLX2 (NM_006650) Human Mass Spec Standard

CAT#: PH310806

CPLX2 MS Standard C13 and N15-labeled recombinant protein (NP_006641)

Product Images

Coomassie blue staining of purified CPLX2 protein (Cat# TP310806). The protein was produced from HEK293T cells transfected with CPLX2 cDNA clone (Cat# RC210806) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210806
• Predicted MW: 15.4 kDa
• Protein Sequence:
  Sequence Link

  >RC210806 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKY
  GLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006641
• RefSeq Size: 4726
• RefSeq ORF: 402
• Synonyms: 921-L; CPX-2; CPX2; Hfb1
• Locus ID: 10814
• UniProt ID: Q6PUV4
• Cytogenetics: 5q35.2
• Summary: Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome