GNG13 (NM_016541) Human Mass Spec Standard

CAT#: PH310828

GNG13 MS Standard C13 and N15-labeled recombinant protein (NP_057625)

Product Images

Coomassie blue staining of purified GNG13 protein (Cat# TP310828). The protein was produced from HEK293T cells transfected with GNG13 cDNA clone (Cat# RC210828) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210828
• Predicted MW: 7.9 kDa
• Protein Sequence:
  Sequence Link

  >RC210828 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057625
• RefSeq Size: 1001
• RefSeq ORF: 201
• Synonyms: G(gamma)13; h2-35
• Locus ID: 51764
• UniProt ID: Q9P2W3
• Cytogenetics: 16p13.3
• Summary: Heterotrimeric G proteins, which consist of alpha (see MIM 139320), beta (see MIM 139380), and gamma subunits, function as signal transducers for the 7-transmembrane-helix G protein-coupled receptors. GNG13 is a gamma subunit that is expressed in taste, retinal, and neuronal tissues and plays a key role in taste transduction (Li et al., 2006 [PubMed 16473877]). [supplied by OMIM, Oct 2009]
• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway, Taste transduction