GNG13 (NM_016541) Human Recombinant Protein
CAT#: TP310828
Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 13 (GNG13)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210828 protein sequence
Red=Cloning site Green=Tags(s) MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 7.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057625 |
Locus ID | 51764 |
UniProt ID | Q9P2W3 |
Cytogenetics | 16p13.3 |
Refseq Size | 1001 |
Refseq ORF | 201 |
Synonyms | G(gamma)13; h2-35 |
Summary | Heterotrimeric G proteins, which consist of alpha (see MIM 139320), beta (see MIM 139380), and gamma subunits, function as signal transducers for the 7-transmembrane-helix G protein-coupled receptors. GNG13 is a gamma subunit that is expressed in taste, retinal, and neuronal tissues and plays a key role in taste transduction (Li et al., 2006 [PubMed 16473877]).[supplied by OMIM, Oct 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Chemokine signaling pathway, Taste transduction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413914 | GNG13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY413914 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 13 (GNG13) |
USD 396.00 |
|
PH310828 | GNG13 MS Standard C13 and N15-labeled recombinant protein (NP_057625) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review