IFNA13 (IFNA1) (NM_024013) Human Mass Spec Standard
CAT#: PH310902
IFNA1 MS Standard C13 and N15-labeled recombinant protein (NP_076918)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210902 |
Predicted MW | 21.7 kDa |
Protein Sequence |
>RC210902 protein sequence
Red=Cloning site Green=Tags(s) MASPFALLMALVVLSCKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQ FQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSI LAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_076918 |
RefSeq Size | 863 |
RefSeq ORF | 567 |
Synonyms | IFL; IFN; IFN-ALPHA; IFN-alphaD; IFNA13; IFNA@ |
Locus ID | 3439 |
UniProt ID | P01562, L0N195 |
Cytogenetics | 9p21.3 |
Summary | 'This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded cytokine is a member of the type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. This cytokine is upregulated in preeclamptic placentas and is thought to be a mediator of preeclampsia. [provided by RefSeq, Aug 2020]' |
Protein Families | Druggable Genome |
Protein Pathways | Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402974 | IFNA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402974 | Transient overexpression lysate of interferon, alpha 1 (IFNA1) |
USD 325.00 |
|
TP310902 | Recombinant protein of human interferon, alpha 1 (IFNA1) |
USD 823.00 |
|
TP721103 | Purified recombinant protein of Human interferon, alpha 1 (IFNA1) |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review