IFNA13 (IFNA1) (NM_024013) Human Recombinant Protein

CAT#: TP721103

Purified recombinant protein of Human interferon, alpha 1 (IFNA1)

Specifications

Product Data

• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKEVDHHHHHH
• Tag: C-His
• Predicted MW: 20.4 kDa
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM PB,150mM NaCl,pH7.4
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_076918
• Locus ID: 3439
• UniProt ID: P01562, L0N195
• Cytogenetics: 9p21.3
• Refseq Size: 863
• Refseq ORF: 567
• Synonyms: IFL; IFN; IFN-ALPHA; IFN-alphaD; IFNA13; IFNA@
• Summary: 'This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded cytokine is a member of the type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. This cytokine is upregulated in preeclamptic placentas and is thought to be a mediator of preeclampsia. [provided by RefSeq, Aug 2020]'
• Protein Families: Druggable Genome
• Protein Pathways: Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway