INSL5 (NM_005478) Human Mass Spec Standard

CAT#: PH310968

INSL5 MS Standard C13 and N15-labeled recombinant protein (NP_005469)

Product Images

Coomassie blue staining of purified INSL5 protein (Cat# TP310968). The protein was produced from HEK293T cells transfected with INSL5 cDNA clone (Cat# RC210968) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210968
• Predicted MW: 15.3 kDa
• Protein Sequence:
  Sequence Link

  >RC210968 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHLEGIPQAQQAETGNSFQLPHK
  REFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005469
• RefSeq Size: 718
• RefSeq ORF: 405
• Synonyms: PRO182; UNQ156
• Locus ID: 10022
• UniProt ID: Q9Y5Q6
• Cytogenetics: 1p31.3
• Summary: The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7). [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein