INSL5 (NM_005478) Human Recombinant Protein

CAT#: TP310968

Recombinant protein of human insulin-like 5 (INSL5)

Product Images

Coomassie blue staining of purified INSL5 protein (Cat# TP310968). The protein was produced from HEK293T cells transfected with INSL5 cDNA clone (Cat# RC210968) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210968 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHLEGIPQAQQAETGNSFQLPHK
  REFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005469
• Locus ID: 10022
• UniProt ID: Q9Y5Q6
• Cytogenetics: 1p31.3
• Refseq Size: 718
• Refseq ORF: 405
• Synonyms: PRO182; UNQ156
• Summary: The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7). [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein