INSL5 (NM_005478) Human Recombinant Protein
CAT#: TP310968
Recombinant protein of human insulin-like 5 (INSL5)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210968 protein sequence
Red=Cloning site Green=Tags(s) MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHLEGIPQAQQAETGNSFQLPHK REFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005469 |
Locus ID | 10022 |
UniProt ID | Q9Y5Q6 |
Cytogenetics | 1p31.3 |
Refseq Size | 718 |
Refseq ORF | 405 |
Synonyms | PRO182; UNQ156 |
Summary | The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7). [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417280 | INSL5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY417280 | Transient overexpression lysate of insulin-like 5 (INSL5) |
USD 325.00 |
|
PH310968 | INSL5 MS Standard C13 and N15-labeled recombinant protein (NP_005469) |
USD 2,055.00 |
|
TP723251 | Purified recombinant protein of Human insulin-like 5 (INSL5). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review