VAX1 (NM_199131) Human Mass Spec Standard

CAT#: PH310985

VAX1 MS Standard C13 and N15-labeled recombinant protein (NP_954582)

Product Images

Coomassie blue staining of purified VAX1 protein (Cat# TP310985). The protein was produced from HEK293T cells transfected with VAX1 cDNA clone (Cat# RC210985) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210985
• Predicted MW: 21 kDa
• Protein Sequence:
  Sequence Link

  >RC210985 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFGKPDKMDVRCHSDAEAARVSKNAHKESRESKGAEGNLPAAFLKEPQGAFSASGAAEDCNKSKSNSAAD
  PDYCRRILVRDAKGSIREIILPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLS
  ETQANSEENNERFKRGIKKQKKKRKKEPANDESRRGDSGGRGWQPL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_954582
• RefSeq Size: 4494
• RefSeq ORF: 558
• Synonyms: MCOPS11
• Locus ID: 11023
• UniProt ID: Q5SQQ9
• Cytogenetics: 10q25.3
• Summary: This gene encodes a homeo-domain containing protein from a class of homeobox transcription factors which are conserved in vertebrates. Genes of this family are involved in the regulation of body development and morphogenesis. The most conserved genes, called HOX genes are found in special gene clusters. This gene belongs to the VAX subfamily and lies in the vicinity of the EMX homeobox gene family. Another member of VAX family is located on chromosome 2. The encoded protein may play an important role in the development of anterior ventral forebrain and visual system. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors