SERPINB13 (NM_012397) Human Mass Spec Standard

CAT#: PH311032

SERPINB13 MS Standard C13 and N15-labeled recombinant protein (NP_036529)

Product Images

Coomassie blue staining of purified SERPINB13 protein (Cat# TP311032). The protein was produced from HEK293T cells transfected with SERPINB13 cDNA clone (Cat# RC211032) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211032
• Predicted MW: 44.3 kDa
• Protein Sequence:
  Sequence Link

  >RC211032 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDSLGAVSTRLGFDLFKELKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKA
  EEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNA
  ADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKENTKEEKFWMNKSTSKS
  VQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERK
  VNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATG
  IGFTVTSAPGHENVHCNHPFLFFIRHNESNSILFFGRFSSP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036529
• RefSeq Size: 3197
• RefSeq ORF: 1173
• Synonyms: headpin; HSHUR7SEQ; HUR7; PI13
• Locus ID: 5275
• UniProt ID: Q9UIV8
• Cytogenetics: 18q21.33
• Summary: 'The protein encoded by this gene is a member of the serpin family of serine protease inhibitors. The encoded protein inhibits the activity of cathepsin K and is itself transcriptionally repressed by RUNX1. This gene is downregulated in many types of cancer. [provided by RefSeq, Jan 2017]'
• Protein Families: Druggable Genome, Transmembrane