VMA21 (NM_001017980) Human Mass Spec Standard

CAT#: PH311043

VMA21 MS Standard C13 and N15-labeled recombinant protein (NP_001017980)

Product Images

Coomassie blue staining of purified VMA21 protein (Cat# TP311043). The protein was produced from HEK293T cells transfected with VMA21 cDNA clone (Cat# RC211043) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211043
• Predicted MW: 11.4 kDa
• Protein Sequence:
  Sequence Link

  >RC211043 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMSNRDSYFYAAI
  VAVVAVHVVLALFVYVAWNEGSRQWREGKQD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001017980
• RefSeq Size: 4760
• RefSeq ORF: 303
• Synonyms: MEAX; XMEA
• Locus ID: 203547
• UniProt ID: Q3ZAQ7
• Cytogenetics: Xq28
• Summary: This gene encodes a chaperone for assembly of lysosomal vacuolar ATPase. [provided by RefSeq, Jul 2012]
• Protein Families: Transmembrane