ARA9 (AIP) (NM_003977) Human Mass Spec Standard

CAT#: PH311157

AIP MS Standard C13 and N15-labeled recombinant protein (NP_003968)

Product Images

Coomassie blue staining of purified AIP protein (Cat# TP311157). The protein was produced from HEK293T cells transfected with AIP cDNA clone (Cat# RC211157) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211157
• Predicted MW: 37.7 kDa
• Protein Sequence:
  Sequence Link

  >RC211157 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKL
  PVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDA
  LQQNPQPLIFHMEMLKVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLK
  NLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWN
  AQEAQADFAKVLELDPALAPVVSRELRALEARIRQKDEEDKARFRGIFSH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003968
• RefSeq Size: 1250
• RefSeq ORF: 990
• Synonyms: ARA9; FKBP16; FKBP37; PITA1; SMTPHN; XAP-2; XAP2
• Locus ID: 9049
• UniProt ID: O00170, G9I2H4
• Cytogenetics: 11q13.2
• Summary: The protein encoded by this gene is a receptor for aryl hydrocarbons and a ligand-activated transcription factor. The encoded protein is found in the cytoplasm as part of a multiprotein complex, but upon binding of ligand is transported to the nucleus. This protein can regulate the expression of many xenobiotic metabolizing enzymes. Also, the encoded protein can bind specifically to and inhibit the activity of hepatitis B virus. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2014]
• Protein Families: Druggable Genome, Transcription Factors