FAM107B (NM_031453) Human Mass Spec Standard

CAT#: PH311413

FAM107B MS Standard C13 and N15-labeled recombinant protein (NP_113641)

Product Images

Coomassie blue staining of purified FAM107B protein (Cat# TP311413). The protein was produced from HEK293T cells transfected with FAM107B cDNA clone (Cat# RC211413) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211413
• Predicted MW: 34.6 kDa
• Protein Sequence:
  Sequence Link

  >RC211413 representing NM_031453
  Red=Cloning site Green=Tags(s)
  
  MSTWKARLTKRLKSPSRSMHPFPCSALLACFGNTRESASFNQSGVADTHSTVRVQPVAKAGRQPRHPSAE
  GAPEKRQDSSTHAERNGSANRNSSHRTAAQPAETPEDVPGSLDDGADCEAVVFHASIPRPSIIDTPKEEE
  FREEPKCLELEQKMTSDSPPEDIDHKDSYLITRSIMAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHR
  ELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQ
  ENAPEFVKVKGNLRRTGQEVAQAQES
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_113641
• RefSeq Size: 3785
• RefSeq ORF: 918
• Synonyms: C10orf45; HITS
• Locus ID: 83641
• UniProt ID: Q9H098
• Cytogenetics: 10p13