RBM38 (NM_183425) Human Mass Spec Standard

CAT#: PH311451

RBM38 MS Standard C13 and N15-labeled recombinant protein (NP_906270)

Product Images

Coomassie blue staining of purified RBM38 protein (Cat# TP311451). The protein was produced from HEK293T cells transfected with RBM38 cDNA clone (Cat# RC211451) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211451
• Predicted MW: 12.7 kDa
• Protein Sequence:
  Sequence Link

  >RC211451 representing NM_183425
  Red=Cloning site Green=Tags(s)
  
  MLLQPAPCAPSAGFPRPLAAPGAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQ
  TGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQTG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_906270
• RefSeq Size: 2346
• RefSeq ORF: 363
• Synonyms: dJ800J21.2; HSRNASEB; RNPC1; SEB4B; SEB4D
• Locus ID: 55544
• UniProt ID: Q9H0Z9
• Cytogenetics: 20q13.31