TOX2 (NM_001098796) Human Mass Spec Standard
CAT#: PH311560
TOX2 MS Standard C13 and N15-labeled recombinant protein (NP_001092266)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211560 |
Predicted MW | 48.9 kDa |
Protein Sequence |
>RC211560 representing NM_001098796
Red=Cloning site Green=Tags(s) MSDGNPELLSTSQTYNGQSENNEDYEIPPITPPNLPEPSLLHLGDHEASYHSLCHGLTPNGLLPAYSYQA MDLPAIMVSNMLAQDSHLLSGQLPTIQEMVHSEVAAYDSGRPGPLLGRPAMLASHMSALSQSQLISQMGI RSSIAHSSPSPPGSKSATPSPSSSTQEEESEVHFKISGEKRPSADPGKKAKNPKKKKKKDPNEPQKPVSA YALFFRDTQAAIKGQNPSATFGDVSKIVASMWDSLGEEQKQAYKRKTEAAKKEYLKALAAYRASLVSKSS PDQGETKSTQANPPAKMLPPKQPMYAMPGLASFLTPSDLQAFRSGASPASLARTLGSKSLLPGLSASPPP PPSFPLSPTLHQQLSLPPHAQGALLSPPVSMSPAPQPPVLPTPMALQVQLAMSPSPPGPQDFPHISEFPS SSGSCSPGPSNPTSSGDWDSSYPSGECGISTCSLLPRDKSLYLT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001092266 |
RefSeq Size | 2433 |
RefSeq ORF | 1392 |
Synonyms | C20orf100; dJ495O3.1; dJ1108D11.2; GCX-1; GCX1 |
Locus ID | 84969 |
UniProt ID | Q96NM4 |
Cytogenetics | 20q13.12 |
Summary | Putative transcriptional activator involved in the hypothalamo-pituitary-gonadal system. [UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409809 | TOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC420333 | TOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC420334 | TOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC420335 | TOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC426045 | TOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY409809 | Transient overexpression lysate of TOX high mobility group box family member 2 (TOX2), transcript variant 3 |
USD 605.00 |
|
LY420333 | Transient overexpression lysate of TOX high mobility group box family member 2 (TOX2), transcript variant 4 |
USD 605.00 |
|
LY420334 | Transient overexpression lysate of TOX high mobility group box family member 2 (TOX2), transcript variant 1 |
USD 605.00 |
|
LY420335 | Transient overexpression lysate of TOX high mobility group box family member 2 (TOX2), transcript variant 2 |
USD 605.00 |
|
LY426045 | Transient overexpression lysate of TOX high mobility group box family member 2 (TOX2), transcript variant 4 |
USD 396.00 |
|
TP311560 | Recombinant protein of human TOX high mobility group box family member 2 (TOX2), transcript variant 4 |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review