TOX2 (NM_001098796) Human Recombinant Protein

CAT#: TP311560

Recombinant protein of human TOX high mobility group box family member 2 (TOX2), transcript variant 4

Product Images

Coomassie blue staining of purified TOX2 protein (Cat# TP311560). The protein was produced from HEK293T cells transfected with TOX2 cDNA clone (Cat# RC211560) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC211560 representing NM_001098796
  Red=Cloning site Green=Tags(s)
  
  MSDGNPELLSTSQTYNGQSENNEDYEIPPITPPNLPEPSLLHLGDHEASYHSLCHGLTPNGLLPAYSYQA
  MDLPAIMVSNMLAQDSHLLSGQLPTIQEMVHSEVAAYDSGRPGPLLGRPAMLASHMSALSQSQLISQMGI
  RSSIAHSSPSPPGSKSATPSPSSSTQEEESEVHFKISGEKRPSADPGKKAKNPKKKKKKDPNEPQKPVSA
  YALFFRDTQAAIKGQNPSATFGDVSKIVASMWDSLGEEQKQAYKRKTEAAKKEYLKALAAYRASLVSKSS
  PDQGETKSTQANPPAKMLPPKQPMYAMPGLASFLTPSDLQAFRSGASPASLARTLGSKSLLPGLSASPPP
  PPSFPLSPTLHQQLSLPPHAQGALLSPPVSMSPAPQPPVLPTPMALQVQLAMSPSPPGPQDFPHISEFPS
  SSGSCSPGPSNPTSSGDWDSSYPSGECGISTCSLLPRDKSLYLT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 48.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001092266
• Locus ID: 84969
• UniProt ID: Q96NM4
• Cytogenetics: 20q13.12
• Refseq Size: 2433
• Refseq ORF: 1392
• Synonyms: C20orf100; dJ495O3.1; dJ1108D11.2; GCX-1; GCX1
• Summary: Putative transcriptional activator involved in the hypothalamo-pituitary-gonadal system.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors