S100 Calcium Binding Protein A13 (S100A13) (NM_001024211) Human Mass Spec Standard
CAT#: PH311660
S100A13 MS Standard C13 and N15-labeled recombinant protein (NP_001019382)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211660 |
Predicted MW | 11.5 kDa |
Protein Sequence |
>RC211660 protein sequence
Red=Cloning site Green=Tags(s) MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSE LKFNEYWRLIGELAKEIRKKKDLKIRKK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001019382 |
RefSeq Size | 667 |
RefSeq ORF | 294 |
Locus ID | 6284 |
UniProt ID | Q99584 |
Cytogenetics | 1q21.3 |
Summary | 'The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is widely expressed in various types of tissues with a high expression level in thyroid gland. In smooth muscle cells, this protein co-expresses with other family members in the nucleus and in stress fibers, suggesting diverse functions in signal transduction. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416946 | S100A13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422618 | S100A13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422619 | S100A13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422620 | S100A13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422621 | S100A13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425441 | S100A13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425442 | S100A13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425443 | S100A13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425444 | S100A13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY416946 | Transient overexpression lysate of S100 calcium binding protein A13 (S100A13), transcript variant 2 |
USD 325.00 |
|
LY422618 | Transient overexpression lysate of S100 calcium binding protein A13 (S100A13), transcript variant 1 |
USD 325.00 |
|
LY422619 | Transient overexpression lysate of S100 calcium binding protein A13 (S100A13), transcript variant 3 |
USD 325.00 |
|
LY422620 | Transient overexpression lysate of S100 calcium binding protein A13 (S100A13), transcript variant 4 |
USD 325.00 |
|
LY422621 | Transient overexpression lysate of S100 calcium binding protein A13 (S100A13), transcript variant 5 |
USD 325.00 |
|
LY425441 | Transient overexpression lysate of S100 calcium binding protein A13 (S100A13), transcript variant 1 |
USD 325.00 |
|
LY425442 | Transient overexpression lysate of S100 calcium binding protein A13 (S100A13), transcript variant 3 |
USD 325.00 |
|
LY425443 | Transient overexpression lysate of S100 calcium binding protein A13 (S100A13), transcript variant 4 |
USD 325.00 |
|
LY425444 | Transient overexpression lysate of S100 calcium binding protein A13 (S100A13), transcript variant 5 |
USD 325.00 |
|
PH310001 | S100A13 MS Standard C13 and N15-labeled recombinant protein (NP_001019381) |
USD 2,055.00 |
|
PH311720 | S100A13 MS Standard C13 and N15-labeled recombinant protein (NP_001019384) |
USD 2,055.00 |
|
PH318914 | S100A13 MS Standard C13 and N15-labeled recombinant protein (NP_001019383) |
USD 2,055.00 |
|
PH322165 | S100A13 MS Standard C13 and N15-labeled recombinant protein (NP_005970) |
USD 2,055.00 |
|
TP310001 | Purified recombinant protein of Homo sapiens S100 calcium binding protein A13 (S100A13), transcript variant 1 |
USD 823.00 |
|
TP311660 | Purified recombinant protein of Homo sapiens S100 calcium binding protein A13 (S100A13), transcript variant 3 |
USD 748.00 |
|
TP311720 | Purified recombinant protein of Homo sapiens S100 calcium binding protein A13 (S100A13), transcript variant 5 |
USD 748.00 |
|
TP318914 | Purified recombinant protein of Homo sapiens S100 calcium binding protein A13 (S100A13), transcript variant 4 |
USD 748.00 |
|
TP322165 | Recombinant protein of human S100 calcium binding protein A13 (S100A13), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review