S100 Calcium Binding Protein A13 (S100A13) (NM_005979) Human Mass Spec Standard

CAT#: PH322165

S100A13 MS Standard C13 and N15-labeled recombinant protein (NP_005970)

Product Images

Coomassie blue staining of purified S100A13 protein (Cat# TP322165). The protein was produced from HEK293T cells transfected with S100A13 cDNA clone (Cat# RC222165) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222165
• Predicted MW: 11.5 kDa
• Protein Sequence:
  Sequence Link

  >RC222165 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSE
  LKFNEYWRLIGELAKEIRKKKDLKIRKK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005970
• RefSeq Size: 743
• RefSeq ORF: 294
• Synonyms: OTTHUMP00000034802; S100 calcium-binding protein A13; S100 calcium binding protein A13
• Locus ID: 6284
• UniProt ID: Q99584
• Cytogenetics: 1q21.3
• Summary: 'The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is widely expressed in various types of tissues with a high expression level in thyroid gland. In smooth muscle cells, this protein co-expresses with other family members in the nucleus and in stress fibers, suggesting diverse functions in signal transduction. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome