HES1 (NM_005524) Human Mass Spec Standard

CAT#: PH311709

HES1 MS Standard C13 and N15-labeled recombinant protein (NP_005515)

Product Images

Coomassie blue staining of purified HES1 protein (Cat# TP311709). The protein was produced from HEK293T cells transfected with HES1 cDNA clone (Cat# RC211709) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211709
• Predicted MW: 29.4 kDa
• Protein Sequence:
  Sequence Link

  >RC211709 representing NM_005524
  Red=Cloning site Green=Tags(s)
  
  MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSS
  RHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLL
  GHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAG
  EAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005515
• RefSeq Size: 1471
• RefSeq ORF: 840
• Synonyms: bHLHb39; HES-1; HHL; HRY
• Locus ID: 3280
• UniProt ID: Q14469
• Cytogenetics: 3q29
• Summary: 'This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. [provided by RefSeq, Jul 2008]'
• Protein Families: Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Stem cell relevant signaling - DSL/Notch pathway, Transcription Factors
• Protein Pathways: Maturity onset diabetes of the young, Notch signaling pathway