CAB39L (NM_001079670) Human Mass Spec Standard
CAT#: PH311881
CAB39L MS Standard C13 and N15-labeled recombinant protein (NP_001073138)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211881 |
Predicted MW | 39.2 kDa |
Protein Sequence |
>RC211881 protein sequence
Red=Cloning site Green=Tags(s) MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKEPPTEAVAQLA QELYSSGLLVTLIADLQLIDFEEKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIAL RCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIF EDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVF VASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKTAP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001073138 |
RefSeq Size | 3580 |
RefSeq ORF | 1011 |
Synonyms | bA103J18.3; MO2L; MO25-BETA |
Locus ID | 81617 |
UniProt ID | Q9H9S4, A0A024RDT3 |
Cytogenetics | 13q14.2 |
Protein Pathways | mTOR signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410660 | CAB39L HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421532 | CAB39L HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425890 | CAB39L HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410660 | Transient overexpression lysate of calcium binding protein 39-like (CAB39L), transcript variant 1 |
USD 396.00 |
|
LY421532 | Transient overexpression lysate of calcium binding protein 39-like (CAB39L), transcript variant 2 |
USD 396.00 |
|
LY425890 | Transient overexpression lysate of calcium binding protein 39-like (CAB39L), transcript variant 2 |
USD 396.00 |
|
PH303394 | CAB39L MS Standard C13 and N15-labeled recombinant protein (NP_112187) |
USD 2,055.00 |
|
TP303394 | Recombinant protein of human calcium binding protein 39-like (CAB39L), transcript variant 1 |
USD 823.00 |
|
TP311881 | Recombinant protein of human calcium binding protein 39-like (CAB39L), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review