CAB39L (NM_001079670) Human Recombinant Protein

CAT#: TP311881

Recombinant protein of human calcium binding protein 39-like (CAB39L), transcript variant 2

Product Images

Coomassie blue staining of purified CAB39L protein (Cat# TP311881). The protein was produced from HEK293T cells transfected with CAB39L cDNA clone (Cat# RC211881) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC211881 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKEPPTEAVAQLA
  QELYSSGLLVTLIADLQLIDFEEKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIAL
  RCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIF
  EDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVF
  VASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKTAP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 38.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001073138
• Locus ID: 81617
• UniProt ID: Q9H9S4, A0A024RDT3
• Cytogenetics: 13q14.2
• Refseq Size: 3580
• Refseq ORF: 1011
• Synonyms: bA103J18.3; MO2L; MO25-BETA
• Summary: Component of a complex that binds and activates STK11/LKB1. In the complex, required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1 (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Pathways: mTOR signaling pathway