gamma Adducin (ADD3) (NM_001121) Human Mass Spec Standard
CAT#: PH311957
ADD3 MS Standard C13 and N15-labeled recombinant protein (NP_001112)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211957 |
Predicted MW | 75.5 kDa |
Protein Sequence |
>RC211957 representing NM_001121
Red=Cloning site Green=Tags(s) MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQSPAFRED LECLIQEQMKKGHNPTGLLALQQIADYIMANSFSGFSSPPLSLGMVTPINDLPGADTSSYVKGEKLTRCK LASLYRLVDLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASNLVKVNIIGEVVDQGSTNLKIDH TGFSPHAAIYSTRPDVKCVIHIHTLATAAVSSMKCGILPISQESLLLGDVAYYDYQGSLEEQEERIQLQK VLGPSCKVLVLRNHGVVALGETLEEAFHYIFNVQLACEIQVQALAGAGGVDNLHVLDFQKYKAFTYTVAA SGGGGVNMGSHQKWKVGEIEFEGLMRTLDNLGYRTGYAYRHPLIREKPRHKSDVEIPATVTAFSFEDDTV PLSPLKYMAQRQQREKTRWLNSPNTYMKVNVPEESRNGETSPRTKITWMKAEDSSKVSGGTPIKIEDPNQ FVPLNTNPNEVLEKRNKIREQNRYDLKTAGPQSQLLAGIVVDKPPSTMQFEDDDHGPPAPPNPFSHLTEG ELEEYKRTIERKQQGLEENHELFSKSFISMEVPVMVVNGKDDMHDVEDELAKRVSRLSTSTTIENIEITI KSPEKIEEVLSPEGSPSKSPSKKKKKFRTPSFLKKNKKKEKVEA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001112 |
RefSeq Size | 4358 |
RefSeq ORF | 2022 |
Synonyms | ADDL; CPSQ3 |
Locus ID | 120 |
UniProt ID | Q9UEY8 |
Cytogenetics | 10q25.1-q25.2 |
Summary | 'Adducins are heteromeric proteins composed of different subunits referred to as adducin alpha, beta and gamma. The three subunits are encoded by distinct genes and belong to a family of membrane skeletal proteins involved in the assembly of spectrin-actin network in erythrocytes and at sites of cell-cell contact in epithelial tissues. While adducins alpha and gamma are ubiquitously expressed, the expression of adducin beta is restricted to brain and hematopoietic tissues. Adducin, originally purified from human erythrocytes, was found to be a heterodimer of adducins alpha and beta. Polymorphisms resulting in amino acid substitutions in these two subunits have been associated with the regulation of blood pressure in an animal model of hypertension. Heterodimers consisting of alpha and gamma subunits have also been described. Structurally, each subunit is comprised of two distinct domains. The amino-terminal region is protease resistant and globular in shape, while the carboxy-terminal region is protease sensitive. The latter contains multiple phosphorylation sites for protein kinase C, the binding site for calmodulin, and is required for association with spectrin and actin. Alternatively spliced adducin gamma transcripts encoding different isoforms have been described. The functions of the different isoforms are not known. [provided by RefSeq, Jul 2008]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402581 | ADD3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC420120 | ADD3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC426532 | ADD3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LY402581 | Transient overexpression lysate of adducin 3 (gamma) (ADD3), transcript variant 1 |
USD 325.00 |
|
LY420120 | Transient overexpression lysate of adducin 3 (gamma) (ADD3), transcript variant 3 |
USD 495.00 |
|
LY426532 | Transient overexpression lysate of adducin 3 (gamma) (ADD3), transcript variant 3 |
USD 495.00 |
|
PH309129 | ADD3 MS Standard C13 and N15-labeled recombinant protein (NP_058432) |
USD 2,055.00 |
|
TP309129 | Recombinant protein of human adducin 3 (gamma) (ADD3), transcript variant 1 |
USD 867.00 |
|
TP311957 | Recombinant protein of human adducin 3 (gamma) (ADD3), transcript variant 3 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review