ISCU (NM_014301) Human Mass Spec Standard
CAT#: PH312031
ISCU MS Standard C13 and N15-labeled recombinant protein (NP_055116)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212031 |
| Predicted MW | 15.1 kDa |
| Protein Sequence |
>RC212031 representing NM_014301
Red=Cloning site Green=Tags(s) MVLIDMSVDLSTQVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGC GSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAE KK myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_055116 |
| RefSeq Size | 1086 |
| RefSeq ORF | 426 |
| Synonyms | 2310020H20Rik; HML; hnifU; ISU2; NIFU; NIFUN |
| Locus ID | 23479 |
| UniProt ID | Q9H1K1, A0A024RBI3, B3KQ30 |
| Cytogenetics | 12q23.3 |
| Summary | This gene encodes a component of the iron-sulfur (Fe-S) cluster scaffold. Fe-S clusters are cofactors that play a role in the function of a diverse set of enzymes, including those that regulate metabolism, iron homeostasis, and oxidative stress response. Alternative splicing results in transcript variants encoding different protein isoforms that localize either to the cytosol or to the mitochondrion. Mutations in this gene have been found in patients with hereditary myopathy with lactic acidosis. A disease-associated mutation in an intron may activate a cryptic splice site, resulting in the production of a splice variant encoding a putatively non-functional protein. A pseudogene of this gene is present on chromosome 1. [provided by RefSeq, Feb 2016] |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403910 | ISCU HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC415371 | ISCU HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429414 | ISCU HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY403910 | Transient overexpression lysate of iron-sulfur cluster scaffold homolog (E. coli) (ISCU), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 436.00 |
|
| LY415371 | Transient overexpression lysate of iron-sulfur cluster scaffold homolog (E. coli) (ISCU), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 436.00 |
|
| LY429414 | Transient overexpression lysate of iron-sulfur cluster scaffold homolog (E. coli) (ISCU), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 396.00 |
|
| TP312031 | Recombinant protein of human iron-sulfur cluster scaffold homolog (E. coli) (ISCU), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China