EDF1 (NM_153200) Human Mass Spec Standard

CAT#: PH312036

EDF1 MS Standard C13 and N15-labeled recombinant protein (NP_694880)

Product Images

Coomassie blue staining of purified EDF1 protein (Cat# TP312036). The protein was produced from HEK293T cells transfected with EDF1 cDNA clone (Cat# RC212036) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212036
• Predicted MW: 15.3 kDa
• Protein Sequence:
  Sequence Link

  >RC212036 representing NM_153200
  Red=Cloning site Green=Tags(s)
  
  MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHH
  DRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGECPSTLRRVR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_694880
• RefSeq Size: 538
• RefSeq ORF: 417
• Synonyms: CFAP280; EDF-1; MBF1
• Locus ID: 8721
• UniProt ID: O60869
• Cytogenetics: 9q34.3
• Summary: This gene encodes a protein that may regulate endothelial cell differentiation, lipid metabolism, and hormone-induced cardiomyocyte hypertrophy. The encoded protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
• Protein Families: Druggable Genome, Transcription Factors