EDF1 (NM_003792) Human Recombinant Protein
CAT#: TP301996
Recombinant protein of human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201996 protein sequence
Red=Cloning site Green=Tags(s) MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHH DRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKP IEKGPRAK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003783 |
Locus ID | 8721 |
UniProt ID | O60869 |
Cytogenetics | 9q34.3 |
Refseq Size | 701 |
Refseq ORF | 444 |
Synonyms | CFAP280; EDF-1; MBF1 |
Summary | This gene encodes a protein that may regulate endothelial cell differentiation, lipid metabolism, and hormone-induced cardiomyocyte hypertrophy. The encoded protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407133 | EDF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC418427 | EDF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430257 | EDF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407133 | Transient overexpression lysate of endothelial differentiation-related factor 1 (EDF1), transcript variant beta |
USD 396.00 |
|
LY418427 | Transient overexpression lysate of endothelial differentiation-related factor 1 (EDF1), transcript variant alpha |
USD 396.00 |
|
LY430257 | Transient overexpression lysate of endothelial differentiation-related factor 1 (EDF1), transcript variant beta |
USD 396.00 |
|
PH301996 | EDF1 MS Standard C13 and N15-labeled recombinant protein (NP_003783) |
USD 2,055.00 |
|
PH312036 | EDF1 MS Standard C13 and N15-labeled recombinant protein (NP_694880) |
USD 2,055.00 |
|
TP312036 | Purified recombinant protein of Homo sapiens endothelial differentiation-related factor 1 (EDF1), transcript variant beta |
USD 748.00 |
|
TP720515 | Recombinant protein of human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review