PPP2R4 (PTPA) (NM_021131) Human Mass Spec Standard

CAT#: PH312144

PPP2R4 MS Standard C13 and N15-labeled recombinant protein (NP_066954)

Product Images

Coomassie blue staining of purified PTPA protein (Cat# TP312144). The protein was produced from HEK293T cells transfected with PTPA cDNA clone (Cat# RC212144) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212144
• Predicted MW: 36.6 kDa
• Protein Sequence:
  Sequence Link

  >RC212144 representing NM_021131
  Red=Cloning site Green=Tags(s)
  
  MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRV
  SEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLK
  ESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVW
  GLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISA
  VPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_066954
• RefSeq Size: 2666
• RefSeq ORF: 969
• Synonyms: PP2A; PPP2R4; PR53
• Locus ID: 5524
• UniProt ID: Q15257
• Cytogenetics: 9q34.11
• Summary: 'Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B' family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Phosphatase