PPP2R4 (PTPA) (NM_178000) Human Recombinant Protein
CAT#: TP300671
Recombinant protein of human protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200671 protein sequence
Red=Cloning site Green=Tags(s) MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRV SEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLK ESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVW GLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISA VPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_821067 |
Locus ID | 5524 |
UniProt ID | Q15257, Q15257-2 |
Cytogenetics | 9q34.11 |
Refseq Size | 2764 |
Refseq ORF | 969 |
Synonyms | PP2A; PPP2R4; PR53 |
Summary | Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B' family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406041 | PPP2R4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC406042 | PPP2R4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC406043 | PPP2R4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC412071 | PPP2R4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429647 | PPP2R4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430488 | PPP2R4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430489 | PPP2R4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY406041 | Transient overexpression lysate of protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 2 |
USD 396.00 |
|
LY406042 | Transient overexpression lysate of protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 1 |
USD 396.00 |
|
LY406043 | Transient overexpression lysate of protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 5 |
USD 396.00 |
|
LY412071 | Transient overexpression lysate of protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 3 |
USD 396.00 |
|
LY429647 | Transient overexpression lysate of protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 3 |
USD 396.00 |
|
LY430488 | Transient overexpression lysate of protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 1 |
USD 396.00 |
|
LY430489 | Transient overexpression lysate of protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 5 |
USD 396.00 |
|
PH300671 | PPP2R4 MS Standard C13 and N15-labeled recombinant protein (NP_821067) |
USD 2,055.00 |
|
PH312144 | PPP2R4 MS Standard C13 and N15-labeled recombinant protein (NP_066954) |
USD 2,055.00 |
|
TP312144 | Recombinant protein of human protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review