SULT1A1 (NM_177534) Human Mass Spec Standard

CAT#: PH312198

SULT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_803878)

Product Images

Coomassie blue staining of purified SULT1A1 protein (Cat# TP312198). The protein was produced from HEK293T cells transfected with SULT1A1 cDNA clone (Cat# RC212198) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212198
• Predicted MW: 34 kDa
• Protein Sequence:
  Sequence Link

  >RC212198 representing NM_177534
  Red=Cloning site Green=Tags(s)
  
  MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKC
  HRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYY
  HFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEF
  VGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADY
  AEKMAGCSLSFRSEL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_803878
• RefSeq Size: 1598
• RefSeq ORF: 885
• Synonyms: HAST1/HAST2; P-PST; PST; ST1A1; ST1A3; STP; STP1; TSPST1
• Locus ID: 6817
• UniProt ID: P50225
• Cytogenetics: 16p11.2
• Summary: 'Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]'
• Protein Pathways: Sulfur metabolism