Decorin (DCN) (NM_133503) Human Mass Spec Standard
CAT#: PH312223
DCN MS Standard C13 and N15-labeled recombinant protein (NP_598010)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212223 |
Predicted MW | 39.7 kDa |
Protein Sequence |
>RC212223 protein sequence
Red=Cloning site Green=Tags(s) MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDL GLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQ LKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADT NITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNK LTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVR SAIQLGNYK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_598010 |
RefSeq Size | 2151 |
RefSeq ORF | 1077 |
Synonyms | CSCD; DSPG2; PG40; PGII; PGS2; SLRR1B |
Locus ID | 1634 |
UniProt ID | P07585, Q6FH10 |
Cytogenetics | 12q21.33 |
Summary | 'This gene encodes a member of the small leucine-rich proteoglycan family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. This protein plays a role in collagen fibril assembly. Binding of this protein to multiple cell surface receptors mediates its role in tumor suppression, including a stimulatory effect on autophagy and inflammation and an inhibitory effect on angiogenesis and tumorigenesis. This gene and the related gene biglycan are thought to be the result of a gene duplication. Mutations in this gene are associated with congenital stromal corneal dystrophy in human patients. [provided by RefSeq, Nov 2015]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | TGF-beta signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403339 | DCN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC419655 | DCN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429085 | DCN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403339 | Transient overexpression lysate of decorin (DCN), transcript variant A2 |
USD 396.00 |
|
LY419655 | Transient overexpression lysate of decorin (DCN), transcript variant A1 |
USD 396.00 |
|
LY429085 | Transient overexpression lysate of decorin (DCN), transcript variant A1 |
USD 396.00 |
|
PH302753 | DCN MS Standard C13 and N15-labeled recombinant protein (NP_001911) |
USD 2,055.00 |
|
PH318427 | DCN MS Standard C13 and N15-labeled recombinant protein (NP_598013) |
USD 2,055.00 |
|
TP302753 | Recombinant protein of human decorin (DCN), transcript variant A1 |
USD 439.00 |
|
TP312223 | Recombinant protein of human decorin (DCN), transcript variant A2 |
USD 748.00 |
|
TP318427 | Recombinant protein of human decorin (DCN), transcript variant D |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review