CRYL1 (NM_015974) Human Mass Spec Standard

CAT#: PH312304

CRYL1 MS Standard C13 and N15-labeled recombinant protein (NP_057058)

Product Images

Coomassie blue staining of purified CRYL1 protein (Cat# TP312304). The protein was produced from HEK293T cells transfected with CRYL1 cDNA clone (Cat# RC212304) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212304
• Predicted MW: 35.2 kDa
• Protein Sequence:
  Sequence Link

  >RC212304 representing NM_015974
  Red=Cloning site Green=Tags(s)
  
  MASSAAGCVVIVGSGVIGRSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAGSLKGSLSVEE
  QLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLMPSKLFAGLVHVKQ
  CIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIGQCPMRVQKEVAGFVLNRLQYAIISEAWRLV
  EEGIVSPSDLDLVMSEGLGMRYAFIGPLETMHLNAEGMLSYCDRYSEGIKHVLQTFGPIPEFSRATAEKV
  NQDMCMKVPDDPEHLAARRQWRDECLMRLAKLKSQVQPQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057058
• RefSeq Size: 1516
• RefSeq ORF: 957
• Synonyms: GDH; gul3DH; HEL30; lambda-CRY
• Locus ID: 51084
• UniProt ID: Q9Y2S2, V9HWG2
• Cytogenetics: 13q12.11
• Summary: The uronate cycle functions as an alternative glucose metabolic pathway, accounting for about 5% of daily glucose catabolism. The product of this gene catalyzes the dehydrogenation of L-gulonate into dehydro-L-gulonate in the uronate cycle. The enzyme requires NAD(H) as a coenzyme, and is inhibited by inorganic phosphate. A similar gene in the rabbit is thought to serve a structural role in the lens of the eye. [provided by RefSeq, Jul 2008]