CRYL1 (NM_015974) Human Recombinant Protein

CAT#: TP312304

Recombinant protein of human crystallin, lambda 1 (CRYL1)

Product Images

Coomassie blue staining of purified CRYL1 protein (Cat# TP312304). The protein was produced from HEK293T cells transfected with CRYL1 cDNA clone (Cat# RC212304) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212304 representing NM_015974
  Red=Cloning site Green=Tags(s)
  
  MASSAAGCVVIVGSGVIGRSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAGSLKGSLSVEE
  QLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLMPSKLFAGLVHVKQ
  CIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIGQCPMRVQKEVAGFVLNRLQYAIISEAWRLV
  EEGIVSPSDLDLVMSEGLGMRYAFIGPLETMHLNAEGMLSYCDRYSEGIKHVLQTFGPIPEFSRATAEKV
  NQDMCMKVPDDPEHLAARRQWRDECLMRLAKLKSQVQPQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057058
• Locus ID: 51084
• UniProt ID: Q9Y2S2, V9HWG2
• Cytogenetics: 13q12.11
• Refseq Size: 1516
• Refseq ORF: 957
• Synonyms: GDH; gul3DH; HEL30; lambda-CRY
• Summary: The uronate cycle functions as an alternative glucose metabolic pathway, accounting for about 5% of daily glucose catabolism. The product of this gene catalyzes the dehydrogenation of L-gulonate into dehydro-L-gulonate in the uronate cycle. The enzyme requires NAD(H) as a coenzyme, and is inhibited by inorganic phosphate. A similar gene in the rabbit is thought to serve a structural role in the lens of the eye. [provided by RefSeq, Jul 2008]