CRYL1 Rabbit Polyclonal Antibody

CAT#: TA344266

Rabbit Polyclonal Anti-CRYL1 Antibody - N-terminal region

Product Images

Host: Rabbit; Target Name: CRYL1; Sample Tissue: Ovary Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CRYL1 antibody is: synthetic peptide directed towards the N-terminal region of Human CRYL1. Synthetic peptide located within the following region: CVVIVGSGVIGRSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: crystallin lambda 1
• Database Link:
  NP_057058
  Entrez Gene 51084 Human
  UniProt ID Q9Y2S2
• Background: The uronate cycle functions as an alternative glucose metabolic pathway, accounting for about 5% of daily glucose catabolism. The product of this gene catalyzes the dehydrogenation of L-gulonate into dehydro-L-gulonate in the uronate cycle. The enzyme requires NAD(H) as a coenzyme, and is inhibited by inorganic phosphate. A similar gene in the rabbit is thought to serve a structural role in the lens of the eye.
• Synonyms: GDH; HEL30; lambda-CRY
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Mouse: 86%; Dog: 79%; Horse: 79%; Yeast: 77%