PPAR gamma (PPARG) (NM_015869) Human Mass Spec Standard
CAT#: PH312502
PPARG MS Standard C13 and N15-labeled recombinant protein (NP_056953)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212502 |
Predicted MW | 57.4 kDa |
Protein Sequence |
>RC212502 representing NM_015869
Red=Cloning site Green=Tags(s) MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDF SSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECR VCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDM NSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGV HEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETD MSLHPLLQEIYKDLY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_056953 |
RefSeq Size | 1820 |
RefSeq ORF | 1515 |
Synonyms | CIMT1; GLM1; NR1C3; PPARG1; PPARG2; PPARgamma |
Locus ID | 5468 |
UniProt ID | P37231 |
Cytogenetics | 3p25.2 |
Summary | 'This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Protein Pathways | Huntington's disease, Pathways in cancer, PPAR signaling pathway, Thyroid cancer |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402467 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC408558 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC408559 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC417568 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430063 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402467 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 2 |
USD 605.00 |
|
LY408558 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3 |
USD 396.00 |
|
LY408559 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1 |
USD 396.00 |
|
LY417568 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 4 |
USD 396.00 |
|
LY430063 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1 |
USD 396.00 |
|
PH301538 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_619726) |
USD 2,055.00 |
|
PH312181 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_619725) |
USD 2,055.00 |
|
PH312449 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_005028) |
USD 2,055.00 |
|
TP301538 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1 |
USD 867.00 |
|
TP312181 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3 |
USD 748.00 |
|
TP312449 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 4 |
USD 823.00 |
|
TP312502 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review