PPAR gamma (PPARG) (NM_138712) Human Recombinant Protein
CAT#: TP301538
Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201538 protein sequence
Red=Cloning site Green=Tags(s) MTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLK LQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIR LKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESAD LRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIR IFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTR EFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQ LKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_619726 |
Locus ID | 5468 |
UniProt ID | P37231, D2KUA6 |
Cytogenetics | 3p25.2 |
Refseq Size | 1892 |
Refseq ORF | 1431 |
Synonyms | CIMT1; GLM1; NR1C3; PPARG1; PPARG2; PPARG5; PPARgamma |
Summary | This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Protein Pathways | Huntington's disease, Pathways in cancer, PPAR signaling pathway, Thyroid cancer |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402467 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC408558 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC408559 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC417568 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430063 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402467 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 2 |
USD 605.00 |
|
LY408558 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3 |
USD 396.00 |
|
LY408559 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1 |
USD 396.00 |
|
LY417568 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 4 |
USD 396.00 |
|
LY430063 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1 |
USD 396.00 |
|
PH301538 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_619726) |
USD 2,055.00 |
|
PH312181 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_619725) |
USD 2,055.00 |
|
PH312449 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_005028) |
USD 2,055.00 |
|
PH312502 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_056953) |
USD 2,055.00 |
|
TP312181 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3 |
USD 748.00 |
|
TP312449 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 4 |
USD 823.00 |
|
TP312502 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review