IGF1 (NM_000618) Human Mass Spec Standard

CAT#: PH312527

IGF1 MS Standard C13 and N15-labeled recombinant protein (NP_000609)

Product Images

Coomassie blue staining of purified IGF1 protein (Cat# TP312527). The protein was produced from HEK293T cells transfected with IGF1 cDNA clone (Cat# RC212527) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212527
• Predicted MW: 17.03 kDa
• Protein Sequence:
  Sequence Link

  >RC212527 representing NM_000618
  Red=Cloning site Green=Tags(s)
  
  MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRG
  FYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKN
  ASRGSAGNKNYRM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000609
• RefSeq Size: 7260
• RefSeq ORF: 459
• Synonyms: IGF; IGF-I; IGFI; MGF
• Locus ID: 3479
• UniProt ID: P05019, Q5U743, Q59GC5
• Cytogenetics: 12q23.2
• Summary: 'The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Sep 2015]'
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
• Protein Pathways: Dilated cardiomyopathy, Focal adhesion, Glioma, Hypertrophic cardiomyopathy (HCM), Long-term depression, Melanoma, mTOR signaling pathway, Oocyte meiosis, p53 signaling pathway, Pathways in cancer, Progesterone-mediated oocyte maturation, Prostate cancer